PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8NG296600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 497aa    MW: 56469.4 Da    PI: 5.156
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8NG296600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS39.77.5e-1321930115100
                 GRAS  15 gdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                          + l  a++lL++++++as +gd+mqRla++f+++L+arl++++s+l ++l +++ s     e l+a+kl+  +  ++kf  ++ N+
  Pavir.8NG296600.1.p 219 RTLLSARELLKQIKKHASASGDAMQRLAQCFAKGLEARLLGTGSHLWHSLITERPS---LMEFLQAYKLYLAAESFIKFHAIMMNS 301
                          566789*******************************************9999888...9*******************9999885 PP

2GRAS93.53.4e-29292488176373
                 GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll............desv..sleserdevLklvkslsPkvvvvveqeadhnse 251
                          ++f++ ++ + e++ +e+L+++ +E+l+Vn  +  ++              desv  + +s+rd vL+ +++++P+v++ +  + ++ ++
  Pavir.8NG296600.1.p 292 IKFHA-IMMNSEKVCIEDLKTDDDEVLVVNDLFVGENNClvllqtlegtlmDESVffDYPSPRDIVLNNIRNMRPNVFIQSIVNYSC-GS 379
                          58999.578899999**************988866665567889999999966652256679*****************99999999.67 PP

                 GRAS 252 sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                          sFl rf  al+yy+alfd+l+a++pre++ r+ +E+ +lg ++ n++aceg +     e++++W+ r ++aG++++pl+ +++++ k   
  Pavir.8NG296600.1.p 380 SFLSRFHGALSYYTALFDMLDATIPRENQLRVLLEQGFLGHAALNAIACEGVDLMDCPEKYKQWQVRNQRAGLRQLPLKPQIVNELK--- 466
                          9*******************************************************************************9987654... PP

                 GRAS 342 rkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                    e++ ++l++gW ++ L++ S W
  Pavir.8NG296600.1.p 467 ----------EKDGQWLLQGWAGHILFAHSTW 488
                          ..........4566777788888888888888 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098512.416292482IPR005202Transcription factor GRAS
PfamPF035141.2E-26292488IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MATTPEEFFA KGLMDPSPPS PAVFLDFPLM PEGCQGPFSP DDTVLSYVSV MLMEEDTDDN  60
LLYQYSDHPA LFQVQQSFAQ ILCPPSSRVD HDNTNRGDMD GIKDLFQNNN GQDFLPNDNS  120
FRRDELVNCM SRQSSSHCGV KKRHNRDKHQ DEVSRASKAV KMMEEEEIGA YKMFEEMMFH  180
GYKICITSME NLRISMAMES EKNNRKSISI KTRDVVDLRT LLSARELLKQ IKKHASASGD  240
AMQRLAQCFA KGLEARLLGT GSHLWHSLIT ERPSLMEFLQ AYKLYLAAES FIKFHAIMMN  300
SEKVCIEDLK TDDDEVLVVN DLFVGENNCL VLLQTLEGTL MDESVFFDYP SPRDIVLNNI  360
RNMRPNVFIQ SIVNYSCGSS FLSRFHGALS YYTALFDMLD ATIPRENQLR VLLEQGFLGH  420
AALNAIACEG VDLMDCPEKY KQWQVRNQRA GLRQLPLKPQ IVNELKEKDG QWLLQGWAGH  480
ILFAHSTWVA EDVPSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A096TQQ91e-129A0A096TQQ9_MAIZE; Uncharacterized protein
STRINGGRMZM2G425366_P011e-128(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2543445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.15e-44SCARECROW-like 14